PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g20530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 136aa    MW: 16297 Da    PI: 10.5541
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g20530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.3e-192676656
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +ft+eq++ Le++F+   ++  +e+ +LA+ lgL+ rqV +WFqN+Ra++k
  CA03g20530 26 RFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWK 76
                7*************************************************9 PP

2HD-ZIP_I/II1162.2e-3724112391
  HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                   +r+++eqvklLE++F+  +k+ep++K +lar+Lglqprqva+WFqn+RAR+k+kqlE++y+ L++++d+l+++ e+L+ e+e+L  e+
   CA03g20530  24 AKRFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWKSKQLEHEYRILQSKFDHLNTQFESLKIEKERLLIEV 112
                  69*********************************************************************************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.14E-181480IPR009057Homeodomain-like
PROSITE profilePS5007116.5681878IPR001356Homeobox domain
SMARTSM003891.2E-162082IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-202585IPR009057Homeodomain-like
PfamPF000462.8E-162676IPR001356Homeobox domain
CDDcd000863.35E-122679No hitNo description
PRINTSPR000314.5E-64958IPR000047Helix-turn-helix motif
PROSITE patternPS0002705376IPR017970Homeobox, conserved site
PRINTSPR000314.5E-65874IPR000047Helix-turn-helix motif
PfamPF021839.7E-1278112IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MESEHEKSET PNFKRPLKKK CENAKRFTDE QVKLLESMFK LGTKIEPREK LQLARDLGLQ  60
PRQVAIWFQN KRARWKSKQL EHEYRILQSK FDHLNTQFES LKIEKERLLI EVTFSLSLFA  120
SDILRWFILT SFARK*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3684840.0AY368484.1 Capsicum annuum HD-ZIP (HD-Zip) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016564294.18e-74PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotP468973e-37ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLQ6UK173e-74Q6UK17_CAPAN; HD-ZIP
STRINGPGSC0003DMT4000476222e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-38homeobox 7